PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g018800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28443.4 Da    PI: 8.9746
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g018800.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.41.5e-31959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtf+kRrng+lKKA+ELS+LCdaeva+iifss+gklye+ss
  Sopen12g018800.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSSRGKLYEFSS 59
                      79***********************************************96 PP

2K-box99.45.1e-338417311100
             K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                        ++++  ++e+ +Lk+++e Lqr+qRh+lGedL++L+ keL+qLe+qL+ slkk+RskK++ +l+q+ +lq+ke++l+e+nk+L++klee
  Sopen12g018800.1  84 VSDTQMNYNEYVRLKARVELLQRSQRHILGEDLGTLNSKELEQLEHQLDASLKKVRSKKTQSMLDQLADLQEKEQMLEEANKQLKNKLEE 173
                       5678999********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.529161IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-40160IPR002100Transcription factor, MADS-box
CDDcd002652.57E-45279No hitNo description
SuperFamilySSF554555.36E-33278IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-2786171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.83587177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSILCD AEVALIIFSS RGKLYEFSSA  60
SSMMTTLEKY QQCSYASLDP MLPVSDTQMN YNEYVRLKAR VELLQRSQRH ILGEDLGTLN  120
SKELEQLEHQ LDASLKKVRS KKTQSMLDQL ADLQEKEQML EEANKQLKNK LEESAARIPL  180
GLSWGNNGGE TMEYNRLPPQ TTAQPFFQPL RLNSSSPQFG YNPNMGANDH EVNAATTAHN  240
INGFIPGWML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-249317123101Developmental protein SEPALLATA 3
4ox0_B2e-249317123101Developmental protein SEPALLATA 3
4ox0_C2e-249317123101Developmental protein SEPALLATA 3
4ox0_D2e-249317123101Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7188340.0KF718834.1 Solanum lycopersicum MADS-box protein EBI mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015059921.10.0PREDICTED: MADS-box protein CMB1-like
SwissprotQ396851e-100CMB1_DIACA; MADS-box protein CMB1
TrEMBLK4DEK00.0K4DEK0_SOLLC; MADS-box protein EBI
STRINGSolyc12g038510.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.15e-88MIKC_MADS family protein